PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P09690_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 446aa    MW: 49775.1 Da    PI: 6.572
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P09690_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4462.6e-136504411374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lLl+cA++v++g+  +a+a+L+++  la+pdgd+mqR+a++fteALa+r +r +++ly+al ++++     +e++aa++ f +++
  GSMUA_Achr8P09690_001  50 LIHLLLNCANHVAAGSIDRANAFLEQIALLAAPDGDAMQRIASHFTEALARRALRLWPGLYHALDSTRAVVLPLAEAAAARRHFLDLC 137
                            689*************************************************************999999888*************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+l++s+++ NqaI+ea+ege+ vH++D+++s ++QW++Llq L +Rpegpp+l+iTgv++    +ke l++t+ rL++ Ae+l++pf
  GSMUA_Achr8P09690_001 138 PFLRLSYVVSNQAIMEAMEGERVVHVVDLNASDPTQWISLLQGLRARPEGPPHLKITGVHE----HKELLNHTAARLSDEAERLDIPF 221
                            *************************************************************....9********************** PP

                   GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.......................desvsleserdevLklvkslsPkvvvv 241
                            +fn+ v++rl++l++e+Lrvk+gEala++ vlqlh+ll                         ++s++ + +++L l+++lsPk++vv
  GSMUA_Achr8P09690_001 222 QFNA-VVSRLDNLDVESLRVKTGEALAISTVLQLHSLLasndgagdprqaqrtapsalsspFAPASSPARMESFLALLWGLSPKIMVV 308
                            ****.7****************************************************999444455555667*************** PP

                   GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329
                            +eqe++hn + + erf+eal yy+alfd+l++++pr+s er  vE++llg+ei+n++aceg er+erhe+le+W +r+++aGF+p+pl
  GSMUA_Achr8P09690_001 309 TEQESNHNVPALNERFVEALFYYAALFDCLDSTVPRQSVERLRVEKMLLGEEIKNIIACEGWERKERHEKLERWAQRMDMAGFGPLPL 396
                            **************************************************************************************** PP

                   GRAS 330 sekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            s++   qa++ll+ ++ +gy+v+ee+g+++l+W++rpL+s+ aWr
  GSMUA_Achr8P09690_001 397 SYYGLLQARRLLQSFGCEGYKVKEENGCFLLCWQERPLFSIAAWR 441
                            ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.91924421IPR005202Transcription factor GRAS
PfamPF035148.9E-13450441IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MANVVQDEGS SSVTSSPLKT FSLMSLSPPS LSPYSPWLRE LKSDERGLCL IHLLLNCANH  60
VAAGSIDRAN AFLEQIALLA APDGDAMQRI ASHFTEALAR RALRLWPGLY HALDSTRAVV  120
LPLAEAAAAR RHFLDLCPFL RLSYVVSNQA IMEAMEGERV VHVVDLNASD PTQWISLLQG  180
LRARPEGPPH LKITGVHEHK ELLNHTAARL SDEAERLDIP FQFNAVVSRL DNLDVESLRV  240
KTGEALAIST VLQLHSLLAS NDGAGDPRQA QRTAPSALSS PFAPASSPAR MESFLALLWG  300
LSPKIMVVTE QESNHNVPAL NERFVEALFY YAALFDCLDS TVPRQSVERL RVEKMLLGEE  360
IKNIIACEGW ERKERHEKLE RWAQRMDMAG FGPLPLSYYG LLQARRLLQS FGCEGYKVKE  420
ENGCFLLCWQ ERPLFSIAAW RCKRYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-48504414375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260420.0AC226042.1 Musa acuminata clone BAC MA4-52N2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411742.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM0TP220.0M0TP22_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P09690_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3